Lineage for d4ijcb_ (4ijc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081396Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [229247] (2 PDB entries)
  8. 2081400Domain d4ijcb_: 4ijc B: [234865]
    automated match to d4ijrc_
    complexed with gol, so4

Details for d4ijcb_

PDB Entry: 4ijc (more details), 2.1 Å

PDB Description: Crystal structure of arabinose dehydrogenase Ara1 from Saccharomyces cerevisiae
PDB Compounds: (B:) D-arabinose dehydrogenase [NAD(P)+] heavy chain

SCOPe Domain Sequences for d4ijcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijcb_ c.1.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlhpktteiyfslnngvripalglgtanpheklaetkqavkaaikagyrhidtawayete
pfvgeaikelledgsikredlfittkvwpvlwdevdrslneslkalgleyvdlllqhwpl
cfekikdpkgisglvktpvddsgktmyaadgdyletykqlekiyldpndhrvraigvsnf
sieylerlikecrvkptvnqvethphlpqmelrkfcfmhdilltaysplgshgapnlkip
lvkklaekynvtgndllisyhirqgtiviprslnpvrisssiefasltkdelqelndfge
kypvrfidepfaailpeftgngpnldnlky

SCOPe Domain Coordinates for d4ijcb_:

Click to download the PDB-style file with coordinates for d4ijcb_.
(The format of our PDB-style files is described here.)

Timeline for d4ijcb_: