Lineage for d4ihhk_ (4ihh K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706187Protein automated matches [190286] (9 species)
    not a true protein
  7. 2706204Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)
  8. 2706214Domain d4ihhk_: 4ihh K: [234864]
    Other proteins in same PDB: d4ihhj2
    automated match to d4ihfg_
    complexed with mes, pns

Details for d4ihhk_

PDB Entry: 4ihh (more details), 2.13 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production
PDB Compounds: (K:) Acyl carrier protein

SCOPe Domain Sequences for d4ihhk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihhk_ a.28.1.1 (K:) automated matches {Escherichia coli [TaxId: 885275]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidyingh

SCOPe Domain Coordinates for d4ihhk_:

Click to download the PDB-style file with coordinates for d4ihhk_.
(The format of our PDB-style files is described here.)

Timeline for d4ihhk_: