| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein automated matches [190286] (9 species) not a true protein |
| Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries) |
| Domain d4ihhj1: 4ihh J:0-74 [234863] Other proteins in same PDB: d4ihhj2 automated match to d4ihfg_ complexed with mes, pns |
PDB Entry: 4ihh (more details), 2.13 Å
SCOPe Domain Sequences for d4ihhj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihhj1 a.28.1.1 (J:0-74) automated matches {Escherichia coli [TaxId: 885275]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidying
Timeline for d4ihhj1: