SCOPe 2.04: Domain d4ihhi_: 4ihh I:

Lineage for d4ihhi_ (4ihh I:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)

8. Domain d4ihhi_: 4ihh I: [234862]
   automated match to d4ihfg_
   complexed with mes, pns

Details for d4ihhi_

PDB Entry: 4ihh, 2.13 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production

PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d4ihhi_:

Sequence; same for both SEQRES and ATOM records:

>d4ihhi_ a.28.1.1 (I:) automated matches {Escherichia coli [TaxId: 885275]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidying

Timeline for d4ihhi_:

• d4ihhi_ first appeared in SCOPe 2.03
  
• d4ihhi_ appears in SCOPe 2.05
  
• d4ihhi_ appears in the current release, SCOPe 2.08