![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein automated matches [190286] (9 species) not a true protein |
![]() | Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries) |
![]() | Domain d4ihhg_: 4ihh G: [234861] Other proteins in same PDB: d4ihhj2 automated match to d4ihfg_ complexed with mes, pns |
PDB Entry: 4ihh (more details), 2.13 Å
SCOPe Domain Sequences for d4ihhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihhg_ a.28.1.1 (G:) automated matches {Escherichia coli [TaxId: 885275]} eervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaekit tvqaaidyin
Timeline for d4ihhg_:
![]() Domains from other chains: (mouse over for more information) d4ihhi_, d4ihhj1, d4ihhj2, d4ihhk_ |