Lineage for d4ihgh_ (4ihg H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706187Protein automated matches [190286] (9 species)
    not a true protein
  7. 2706204Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)
  8. 2706216Domain d4ihgh_: 4ihg H: [234856]
    automated match to d4ihfg_
    complexed with ftt, pns

Details for d4ihgh_

PDB Entry: 4ihg (more details), 2.89 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production
PDB Compounds: (H:) Acyl carrier protein

SCOPe Domain Sequences for d4ihgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihgh_ a.28.1.1 (H:) automated matches {Escherichia coli [TaxId: 885275]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidying

SCOPe Domain Coordinates for d4ihgh_:

Click to download the PDB-style file with coordinates for d4ihgh_.
(The format of our PDB-style files is described here.)

Timeline for d4ihgh_: