| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein automated matches [190286] (9 species) not a true protein |
| Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries) |
| Domain d4ihfl_: 4ihf L: [234855] automated match to d4ihfg_ complexed with 1f7, cl |
PDB Entry: 4ihf (more details), 2.1 Å
SCOPe Domain Sequences for d4ihfl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihfl_ a.28.1.1 (L:) automated matches {Escherichia coli [TaxId: 885275]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidying
Timeline for d4ihfl_: