SCOPe 2.06: Domain d4ihfk_: 4ihf K:

Lineage for d4ihfk_ (4ihf K:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)

8. Domain d4ihfk_: 4ihf K: [234854]
   automated match to d4ihfg_
   complexed with 1f7, cl

Details for d4ihfk_

PDB Entry: 4ihf, 2.1 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production

PDB Compounds: (K:) Acyl carrier protein

SCOPe Domain Sequences for d4ihfk_:

Sequence; same for both SEQRES and ATOM records:

>d4ihfk_ a.28.1.1 (K:) automated matches {Escherichia coli [TaxId: 885275]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq

Timeline for d4ihfk_:

• d4ihfk_ first appeared in SCOPe 2.03
  
• d4ihfk_ appears in SCOPe 2.05
  
• d4ihfk_ appears in SCOPe 2.07
  
• d4ihfk_ appears in the current release, SCOPe 2.08