Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein automated matches [190286] (9 species) not a true protein |
Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries) |
Domain d4ihfk_: 4ihf K: [234854] automated match to d4ihfg_ complexed with 1f7, cl |
PDB Entry: 4ihf (more details), 2.1 Å
SCOPe Domain Sequences for d4ihfk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihfk_ a.28.1.1 (K:) automated matches {Escherichia coli [TaxId: 885275]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghq
Timeline for d4ihfk_: