SCOPe 2.05: Domain d4ihfi_: 4ihf I:

Lineage for d4ihfi_ (4ihf I:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)

8. Domain d4ihfi_: 4ihf I: [234852]
   automated match to d4ihfg_
   complexed with 1f7, cl

Details for d4ihfi_

PDB Entry: 4ihf, 2.1 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production

PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d4ihfi_:

Sequence; same for both SEQRES and ATOM records:

>d4ihfi_ a.28.1.1 (I:) automated matches {Escherichia coli [TaxId: 885275]}
tieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaek
ittvqaaidying

Timeline for d4ihfi_:

• d4ihfi_ first appeared in SCOPe 2.03
  
• d4ihfi_ appears in SCOPe 2.04
  
• d4ihfi_ appears in SCOPe 2.06
  
• d4ihfi_ appears in the current release, SCOPe 2.08