Lineage for d4ihfi_ (4ihf I:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266819Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1266875Protein automated matches [190286] (7 species)
    not a true protein
  7. 1266892Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)
  8. 1266895Domain d4ihfi_: 4ihf I: [234852]
    automated match to d4ihfg_
    complexed with 1f7, cl

Details for d4ihfi_

PDB Entry: 4ihf (more details), 2.1 Å

PDB Description: chasing acyl carrier protein through a catalytic cycle of lipid a production
PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d4ihfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihfi_ a.28.1.1 (I:) automated matches {Escherichia coli [TaxId: 885275]}
tieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaek
ittvqaaidying

SCOPe Domain Coordinates for d4ihfi_:

Click to download the PDB-style file with coordinates for d4ihfi_.
(The format of our PDB-style files is described here.)

Timeline for d4ihfi_: