SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ihfh_ (4ihf H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1991986Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1991987Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)
  6. 1992046Protein automated matches [190286] (9 species)
    not a true protein
  7. 1992063Species Escherichia coli [TaxId:885275] [228942] (3 PDB entries)
  8. 1992065Domain d4ihfh_: 4ihf H: [234851]
    automated match to d4ihfg_
    complexed with 1f7, cl

Details for d4ihfh_

PDB Entry: 4ihf (more details), 2.1 Å

PDB Description: Chasing Acyl Carrier Protein Through a Catalytic Cycle of Lipid A Production
PDB Compounds: (H:) Acyl carrier protein

SCOPe Domain Sequences for d4ihfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihfh_ a.28.1.1 (H:) automated matches {Escherichia coli [TaxId: 885275]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidying

SCOPe Domain Coordinates for d4ihfh_:

Click to download the PDB-style file with coordinates for d4ihfh_.
(The format of our PDB-style files is described here.)

Timeline for d4ihfh_: