SCOPe 2.04: Domain d4ia8a_: 4ia8 A:

Lineage for d4ia8a_ (4ia8 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (7 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4ia8a_: 4ia8 A: [234841]
   automated match to d4ia8b_
   complexed with so4; mutant

Details for d4ia8a_

PDB Entry: 4ia8, 1.85 Å

PDB Description: Crystal Structure of a Y37A mutant of the Restriction-Modification Controller Protein C.Esp1396I

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4ia8a_:

Sequence; same for both SEQRES and ATOM records:

>d4ia8a_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtaisgiernsrnltikslelimkglev
sdvvffemlikeilkhd

Timeline for d4ia8a_:

• d4ia8a_ first appeared in SCOPe 2.03
  
• d4ia8a_ appears in SCOPe 2.05
  
• d4ia8a_ appears in the current release, SCOPe 2.08