| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Scaptomyza nigrita [TaxId:928823] [229398] (1 PDB entry) |
| Domain d4i97b2: 4i97 B:86-208 [234840] Other proteins in same PDB: d4i97a1, d4i97b1 automated match to d4i97a2 complexed with gsh |
PDB Entry: 4i97 (more details), 2.15 Å
SCOPe Domain Sequences for d4i97b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i97b2 a.45.1.0 (B:86-208) automated matches {Scaptomyza nigrita [TaxId: 928823]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpelykkmeaaveflntflegq
tyaagdsltiadiallatmssfevagydfskyenvnkwyanakkvtpgwdenwagcqefk
kyf
Timeline for d4i97b2: