SCOPe 2.03: Domain d4i7ub_: 4i7u B:

Lineage for d4i7ub_ (4i7u B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Agrobacterium sp. [TaxId:861208] [229400] (3 PDB entries)

8. Domain d4i7ub_: 4i7u B: [234831]
   automated match to d4i7ua_
   complexed with gol

Details for d4i7ub_

PDB Entry: 4i7u, 1.55 Å

PDB Description: Dihydrodipicolinate Synthase of Agrobacterium tumefaciens

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4i7ub_:

Sequence; same for both SEQRES and ATOM records:

>d4i7ub_ c.1.10.0 (B:) automated matches {Agrobacterium sp. [TaxId: 861208]}
hhhhvdddekmfkgsipalitpftdngavdeqafaahvewqiaegsnglvpvgttgespt
lshdehkrvvelcievaakrvpviagagsnntdeaielalhaqdagadallvvtpyynkp
tqkglfahfsavaeavklpiviynipprsvvdmspetmgalvkahknivgvkdatgkldr
vseqriscgkdfiqlsgedstalgfnahggvgcisvsanvaprlcsefqaamlagdyaka
leyqdrlmplhraifmepgvcgtkyalsktrgcnrkvrsplmstlepateaaidaalkha
glmn

Timeline for d4i7ub_:

• d4i7ub_ is new in SCOPe 2.03-stable
  
• d4i7ub_ appears in SCOPe 2.04
  
• d4i7ub_ appears in the current release, SCOPe 2.08, called d4i7ub1