SCOPe 2.03: Domain d4i76b1: 4i76 B:1-75

Lineage for d4i76b1 (4i76 B:1-75)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator TM1030 [140209] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
   Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75

8. Domain d4i76b1: 4i76 B:1-75 [234828]
   Other proteins in same PDB: d4i76a2, d4i76b2
   automated match to d2id6a1
   complexed with edo, oc9

Details for d4i76b1

PDB Entry: 4i76, 2.1 Å

PDB Description: crystal structure of transcriptional regulator tm1030 with octanol

PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d4i76b1:

Sequence; same for both SEQRES and ATOM records:

>d4i76b1 a.4.1.9 (B:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
klqkefenflmknrn

Timeline for d4i76b1:

• d4i76b1 is new in SCOPe 2.03-stable
  
• d4i76b1 appears in SCOPe 2.04
  
• d4i76b1 appears in the current release, SCOPe 2.08