Lineage for d4i6gb1 (4i6g B:21-223)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360394Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1360395Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1360427Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 1360428Protein automated matches [227113] (2 species)
    not a true protein
  7. 1360431Species Mouse (Mus musculus) [TaxId:10090] [226619] (4 PDB entries)
  8. 1360437Domain d4i6gb1: 4i6g B:21-223 [234818]
    Other proteins in same PDB: d4i6ga2, d4i6gb2
    automated match to d4mlpd1
    complexed with fad

Details for d4i6gb1

PDB Entry: 4i6g (more details), 2.2 Å

PDB Description: a vertebrate cryptochrome with FAD
PDB Compounds: (B:) Cryptochrome-2

SCOPe Domain Sequences for d4i6gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6gb1 c.28.1.0 (B:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

SCOPe Domain Coordinates for d4i6gb1:

Click to download the PDB-style file with coordinates for d4i6gb1.
(The format of our PDB-style files is described here.)

Timeline for d4i6gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6gb2