Lineage for d4i6ea2 (4i6e A:224-510)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003513Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2003514Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2003515Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)
  6. 2003546Protein automated matches [228408] (1 species)
    not a true protein
  7. 2003547Species Mouse (Mus musculus) [TaxId:10090] [228409] (5 PDB entries)
  8. 2003555Domain d4i6ea2: 4i6e A:224-510 [234815]
    Other proteins in same PDB: d4i6ea1
    automated match to d4mlpd2

Details for d4i6ea2

PDB Entry: 4i6e (more details), 2.7 Å

PDB Description: A vertebrate cryptochrome
PDB Compounds: (A:) Cryptochrome-2

SCOPe Domain Sequences for d4i6ea2:

Sequence, based on SEQRES records: (download)

>d4i6ea2 a.99.1.1 (A:224-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpavwqggetealarldkhlerkawvanyerprmnansllasptglspylrfgclscrlf
yyrlwdlykkvkrnstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpe
alakwaegktgfpwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdell
ldadfsvnagswmwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiy
epwnapesvqkaakciigvdyprpivnhaetsrlniermkqiyqqls

Sequence, based on observed residues (ATOM records): (download)

>d4i6ea2 a.99.1.1 (A:224-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpavwqggetealarldkhlerkanansllasptglspylrfgclscrlfyyrlwdlykk
vkstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpealakwaegktgf
pwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdellldadfsvnagsw
mwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiyepwnapesvqka
akciigvdyprpivnhaetsrlniermkqiyqqls

SCOPe Domain Coordinates for d4i6ea2:

Click to download the PDB-style file with coordinates for d4i6ea2.
(The format of our PDB-style files is described here.)

Timeline for d4i6ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6ea1