SCOPe 2.08: Domain d4i5bb1: 4i5b B:2-92

Lineage for d4i5bb1 (4i5b B:2-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)

8. Domain d4i5bb1: 4i5b B:2-92 [234812]
   Other proteins in same PDB: d4i5ba1, d4i5ba2, d4i5bb2, d4i5bd1, d4i5bd2, d4i5be2
   automated match to d4i5be1
   fragment; missing more than one-third of the common structure and/or sequence

Details for d4i5bb1

PDB Entry: 4i5b, 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4i5bb1:

Sequence; same for both SEQRES and ATOM records:

>d4i5bb1 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d4i5bb1:

• d4i5bb1 first appeared in SCOPe 2.03
  
• d4i5bb1 appears in SCOPe 2.07