| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
| Domain d4i5ba1: 4i5b A:2-81 [234810] Other proteins in same PDB: d4i5ba2, d4i5bb1, d4i5bb2, d4i5bd2, d4i5be1, d4i5be2 automated match to d4i5bd1 |
PDB Entry: 4i5b (more details), 2.12 Å
SCOPe Domain Sequences for d4i5ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5ba1 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niacdkanleimtkrsnytp
Timeline for d4i5ba1: