Lineage for d4i2vf_ (4i2v F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1861107Protein Uridine phosphorylase [53176] (5 species)
  7. 1861393Species Yersinia pseudotuberculosis [TaxId:633] [229814] (2 PDB entries)
  8. 1861401Domain d4i2vf_: 4i2v F: [234767]
    automated match to d4i2vc_

Details for d4i2vf_

PDB Entry: 4i2v (more details), 2.12 Å

PDB Description: X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d4i2vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2vf_ c.56.2.1 (F:) Uridine phosphorylase {Yersinia pseudotuberculosis [TaxId: 633]}
sdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkavi
vcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslhf
apmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkgs
meewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqeipneetmkateshavk
ivveaarhll

SCOPe Domain Coordinates for d4i2vf_:

Click to download the PDB-style file with coordinates for d4i2vf_.
(The format of our PDB-style files is described here.)

Timeline for d4i2vf_: