SCOPe 2.08: Domain d4i2vd_: 4i2v D:

Lineage for d4i2vd_ (4i2v D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Yersinia pseudotuberculosis [TaxId:633] [229814] (2 PDB entries)

8. Domain d4i2vd_: 4i2v D: [234765]
   automated match to d4i2vc_

Details for d4i2vd_

PDB Entry: 4i2v, 2.12 Å

PDB Description: X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution

PDB Compounds: (D:) Uridine phosphorylase

SCOPe Domain Sequences for d4i2vd_:

Sequence; same for both SEQRES and ATOM records:

>d4i2vd_ c.56.2.1 (D:) Uridine phosphorylase {Yersinia pseudotuberculosis [TaxId: 633]}
sdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkavi
vcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslhf
apmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkgs
meewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqeipneetmkateshavk
ivveaarhll

Timeline for d4i2vd_:

• d4i2vd_ first appeared in SCOPe 2.03
  
• d4i2vd_ appears in SCOPe 2.07