SCOPe 2.07: Domain d4i2ta1: 4i2t A:2-105

Lineage for d4i2ta1 (4i2t A:2-105)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries)

8. Domain d4i2ta1: 4i2t A:2-105 [234763]
   Other proteins in same PDB: d4i2ta2
   automated match to d4i2ua_

Details for d4i2ta1

PDB Entry: 4i2t, 1.4 Å

PDB Description: Crystal structure of the oxidized glutaredoxin from Chlorella sorokiniana T-89

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d4i2ta1:

Sequence; same for both SEQRES and ATOM records:

>d4i2ta1 c.47.1.0 (A:2-105) automated matches {Chlorella sorokiniana [TaxId: 3076]}
saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
lleltggrsvprvfidgqfigggddtdalarngklevmlrnagv

Timeline for d4i2ta1:

• d4i2ta1 first appeared in SCOPe 2.03, called d4i2ta_
  
• d4i2ta1 appears in SCOPe 2.06
  
• d4i2ta1 appears in the current release, SCOPe 2.08