Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries) |
Domain d4i2ta_: 4i2t A: [234763] automated match to d4i2ua_ |
PDB Entry: 4i2t (more details), 1.4 Å
SCOPe Domain Sequences for d4i2ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2ta_ c.47.1.0 (A:) automated matches {Chlorella sorokiniana [TaxId: 3076]} saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy lleltggrsvprvfidgqfigggddtdalarngklevmlrnagvlleh
Timeline for d4i2ta_: