SCOPe 2.06: Domain d4i15a_: 4i15 A:

Lineage for d4i15a_ (4i15 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (4 PDB entries)

8. Domain d4i15a_: 4i15 A: [234762]
   automated match to d3g58a_
   complexed with mg, zn

Details for d4i15a_

PDB Entry: 4i15, 1.65 Å

PDB Description: Crystal structure of TbrPDEB1

PDB Compounds: (A:) Class 1 phosphodiesterase PDEB1

SCOPe Domain Sequences for d4i15a_:

Sequence; same for both SEQRES and ATOM records:

>d4i15a_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervletr

Timeline for d4i15a_:

• d4i15a_ first appeared in SCOPe 2.03
  
• d4i15a_ appears in SCOPe 2.05
  
• d4i15a_ appears in SCOPe 2.07
  
• d4i15a_ appears in the current release, SCOPe 2.08