| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
| Domain d4i09a2: 4i09 A:139-209 [234757] Other proteins in same PDB: d4i09a1, d4i09b1 automated match to d4i09b2 complexed with cmp; mutant |
PDB Entry: 4i09 (more details), 2.05 Å
SCOPe Domain Sequences for d4i09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i09a2 a.4.5.0 (A:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt
Timeline for d4i09a2: