| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (57 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
| Domain d4i0ab2: 4i0a B:139-208 [234755] Other proteins in same PDB: d4i0aa1, d4i0ab1 automated match to d4i0aa2 complexed with cmp, gol; mutant |
PDB Entry: 4i0a (more details), 2.2 Å
SCOPe Domain Sequences for d4i0ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i0ab2 a.4.5.0 (B:139-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg
Timeline for d4i0ab2: