| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
| Domain d4i02b2: 4i02 B:139-209 [234752] Other proteins in same PDB: d4i02a1, d4i02b1, d4i02c1, d4i02d1, d4i02e1, d4i02f1 automated match to d4i02e2 complexed with cmp; mutant |
PDB Entry: 4i02 (more details), 1.75 Å
SCOPe Domain Sequences for d4i02b2:
Sequence, based on SEQRES records: (download)
>d4i02b2 a.4.5.0 (B:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
datgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt
>d4i02b2 a.4.5.0 (B:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
datgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ativvygt
Timeline for d4i02b2: