Lineage for d4i02c2 (4i02 C:139-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694708Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)
  8. 2694719Domain d4i02c2: 4i02 C:139-209 [234751]
    Other proteins in same PDB: d4i02a1, d4i02b1, d4i02c1, d4i02d1, d4i02e1, d4i02f1
    automated match to d4i02e2
    complexed with cmp; mutant

Details for d4i02c2

PDB Entry: 4i02 (more details), 1.75 Å

PDB Description: structure of the mutant Catabolite gene activator protein V140A
PDB Compounds: (C:) Catabolite gene activator

SCOPe Domain Sequences for d4i02c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i02c2 a.4.5.0 (C:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
datgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

SCOPe Domain Coordinates for d4i02c2:

Click to download the PDB-style file with coordinates for d4i02c2.
(The format of our PDB-style files is described here.)

Timeline for d4i02c2: