Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries) |
Domain d4i02a1: 4i02 A:3-138 [234744] Other proteins in same PDB: d4i02a2, d4i02b2, d4i02c2, d4i02d2, d4i02e2, d4i02f2 automated match to d4i02e1 complexed with cmp; mutant |
PDB Entry: 4i02 (more details), 1.75 Å
SCOPe Domain Sequences for d4i02a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i02a1 b.82.3.2 (A:3-138) automated matches {Escherichia coli K-12 [TaxId: 83333]} lgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemil sylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqma rrlqvtsekvgnlafl
Timeline for d4i02a1: