Lineage for d4hzva_ (4hzv A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1326638Protein automated matches [190692] (7 species)
    not a true protein
  7. 1326650Species Influenza A virus [TaxId:11320] [188445] (30 PDB entries)
  8. 1326661Domain d4hzva_: 4hzv A: [234741]
    automated match to d4hzwa_
    complexed with ca, gol

Details for d4hzva_

PDB Entry: 4hzv (more details), 1.8 Å

PDB Description: the crystal structure of influenza a neuraminidase n3
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4hzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzva_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
frpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallg
tkhsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnd
asaqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywireg
kiikyenvpktkiqhleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskf
hsdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvteg
winspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsn
sivtfcgldnepgsgnwpdgsnigfmpk

SCOPe Domain Coordinates for d4hzva_:

Click to download the PDB-style file with coordinates for d4hzva_.
(The format of our PDB-style files is described here.)

Timeline for d4hzva_: