Lineage for d4hyrb2 (4hyr B:134-442)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343858Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1344048Protein automated matches [226997] (6 species)
    not a true protein
  7. 1344049Species Acidaminococcus sp. [TaxId:563191] [234735] (1 PDB entry)
  8. 1344051Domain d4hyrb2: 4hyr B:134-442 [234738]
    Other proteins in same PDB: d4hyra1, d4hyrb1
    automated match to d4g8ta2
    complexed with cl, edo, gol

Details for d4hyrb2

PDB Entry: 4hyr (more details), 1.84 Å

PDB Description: structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4hyrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hyrb2 c.1.11.2 (B:134-442) automated matches {Acidaminococcus sp. [TaxId: 563191]}
agqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneeaidaehvvalckaakn
kygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhlddavryvadmhgilt
ycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghslesqavdiiladphfw
tmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgeynaldthwiwqegrer
ltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgarndaitmqylipgwkf
dakspclvr

SCOPe Domain Coordinates for d4hyrb2:

Click to download the PDB-style file with coordinates for d4hyrb2.
(The format of our PDB-style files is described here.)

Timeline for d4hyrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hyrb1