Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Acidaminococcus sp. [TaxId:563191] [234733] (1 PDB entry) |
Domain d4hyra1: 4hyr A:2-133 [234734] Other proteins in same PDB: d4hyra2, d4hyra3, d4hyrb2, d4hyrb3 automated match to d4g8ta1 complexed with cl, edo, gol |
PDB Entry: 4hyr (more details), 1.84 Å
SCOPe Domain Sequences for d4hyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hyra1 d.54.1.0 (A:2-133) automated matches {Acidaminococcus sp. [TaxId: 563191]} vpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittale nvsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcldllg kaldmpvcrllg
Timeline for d4hyra1: