![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein automated matches [233398] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries) |
![]() | Domain d4hx4b2: 4hx4 B:63-135 [234732] Other proteins in same PDB: d4hx4a1, d4hx4b1 automated match to d1on2a2 complexed with mn; mutant |
PDB Entry: 4hx4 (more details), 1.65 Å
SCOPe Domain Sequences for d4hx4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx4b2 a.76.1.1 (B:63-135) automated matches {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqk
Timeline for d4hx4b2: