Lineage for d4hx4b2 (4hx4 B:63-135)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274457Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1274458Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
    automatically mapped to Pfam PF02742
  5. 1274459Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 1274541Protein automated matches [233398] (2 species)
    not a true protein
  7. 1274542Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries)
  8. 1274544Domain d4hx4b2: 4hx4 B:63-135 [234732]
    Other proteins in same PDB: d4hx4a1, d4hx4b1
    automated match to d1on2a2
    complexed with mn; mutant

Details for d4hx4b2

PDB Entry: 4hx4 (more details), 1.65 Å

PDB Description: Structure of MNTR mutant E11K complexed with Mn2+
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx4b2 a.76.1.1 (B:63-135) automated matches {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqk

SCOPe Domain Coordinates for d4hx4b2:

Click to download the PDB-style file with coordinates for d4hx4b2.
(The format of our PDB-style files is described here.)

Timeline for d4hx4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hx4b1