![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein automated matches [233395] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries) |
![]() | Domain d4hx4b1: 4hx4 B:3-62 [234731] Other proteins in same PDB: d4hx4a2, d4hx4b2 automated match to d1on1a1 complexed with mn; mutant |
PDB Entry: 4hx4 (more details), 1.65 Å
SCOPe Domain Sequences for d4hx4b1:
Sequence, based on SEQRES records: (download)
>d4hx4b1 a.4.5.24 (B:3-62) automated matches {Bacillus subtilis [TaxId: 1423]} tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
>d4hx4b1 a.4.5.24 (B:3-62) automated matches {Bacillus subtilis [TaxId: 1423]} tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl
Timeline for d4hx4b1: