Class a: All alpha proteins [46456] (286 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein automated matches [233398] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries) |
Domain d4hx4a2: 4hx4 A:63-135 [234730] Other proteins in same PDB: d4hx4a1, d4hx4b1 automated match to d1on2a2 complexed with mn; mutant |
PDB Entry: 4hx4 (more details), 1.65 Å
SCOPe Domain Sequences for d4hx4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx4a2 a.76.1.1 (A:63-135) automated matches {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqk
Timeline for d4hx4a2: