SCOPe 2.05: Domain d4hx4a2: 4hx4 A:63-135

Lineage for d4hx4a2 (4hx4 A:63-135)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein automated matches [233398] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries)

8. Domain d4hx4a2: 4hx4 A:63-135 [234730]
   Other proteins in same PDB: d4hx4a1, d4hx4b1
   automated match to d1on2a2
   complexed with mn; mutant

Details for d4hx4a2

PDB Entry: 4hx4, 1.65 Å

PDB Description: Structure of MNTR mutant E11K complexed with Mn2+

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx4a2:

Sequence; same for both SEQRES and ATOM records:

>d4hx4a2 a.76.1.1 (A:63-135) automated matches {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqk

Timeline for d4hx4a2:

• d4hx4a2 first appeared in SCOPe 2.03
  
• d4hx4a2 appears in SCOPe 2.04
  
• d4hx4a2 appears in SCOPe 2.06
  
• d4hx4a2 appears in the current release, SCOPe 2.08