SCOPe 2.06: Domain d4hx3h1: 4hx3 H:1-113

Lineage for d4hx3h1 (4hx3 H:1-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.0: automated matches [193339] (1 protein)
   not a true family

6. Protein automated matches [193340] (1 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)

8. Domain d4hx3h1: 4hx3 H:1-113 [234727]
   Other proteins in same PDB: d4hx3a1, d4hx3a2, d4hx3c1, d4hx3c2, d4hx3e1, d4hx3e2, d4hx3g1, d4hx3g2, d4hx3h2, d4hx3i1, d4hx3i2, d4hx3k1, d4hx3k2
   automated match to d4hx3d_
   complexed with gol, zn

Details for d4hx3h1

PDB Entry: 4hx3, 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin

PDB Compounds: (H:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx3h1:

Sequence, based on SEQRES records:

>d4hx3h1 d.84.1.0 (H:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Sequence, based on observed residues (ATOM records):

>d4hx3h1 d.84.1.0 (H:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
lvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Timeline for d4hx3h1:

• d4hx3h1 first appeared in SCOPe 2.03, called d4hx3h_
  
• d4hx3h1 was called d4hx3h_ in SCOPe 2.05
  
• d4hx3h1 appears in SCOPe 2.07
  
• d4hx3h1 appears in the current release, SCOPe 2.08