Lineage for d4hx3h_ (4hx3 H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916488Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 1916489Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 1916499Family d.84.1.0: automated matches [193339] (1 protein)
    not a true family
  6. 1916500Protein automated matches [193340] (1 species)
    not a true protein
  7. 1916501Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)
  8. 1916508Domain d4hx3h_: 4hx3 H: [234727]
    Other proteins in same PDB: d4hx3a_, d4hx3c_, d4hx3e_, d4hx3g_, d4hx3i_, d4hx3k_
    automated match to d4hx3d_
    complexed with gol, zn

Details for d4hx3h_

PDB Entry: 4hx3 (more details), 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin
PDB Compounds: (H:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx3h_:

Sequence, based on SEQRES records: (download)

>d4hx3h_ d.84.1.0 (H:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
laapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Sequence, based on observed residues (ATOM records): (download)

>d4hx3h_ d.84.1.0 (H:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
llvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

SCOPe Domain Coordinates for d4hx3h_:

Click to download the PDB-style file with coordinates for d4hx3h_.
(The format of our PDB-style files is described here.)

Timeline for d4hx3h_: