![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) ![]() |
![]() | Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
![]() | Protein automated matches [193340] (1 species) not a true protein |
![]() | Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries) |
![]() | Domain d4hx3b_: 4hx3 B: [234725] Other proteins in same PDB: d4hx3a1, d4hx3a2, d4hx3c1, d4hx3c2, d4hx3e1, d4hx3e2, d4hx3g1, d4hx3g2, d4hx3h2, d4hx3i1, d4hx3i2, d4hx3k1, d4hx3k2 automated match to d4hx3d_ complexed with gol, zn |
PDB Entry: 4hx3 (more details), 2.7 Å
SCOPe Domain Sequences for d4hx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx3b_ d.84.1.0 (B:) automated matches {Streptomyces caespitosus [TaxId: 53502]} sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
Timeline for d4hx3b_: