Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) |
Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
Protein automated matches [193340] (2 species) not a true protein |
Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries) |
Domain d4hx2d_: 4hx2 D: [234724] Other proteins in same PDB: d4hx2a_, d4hx2b2, d4hx2c_ automated match to d4hx3d_ complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn |
PDB Entry: 4hx2 (more details), 2.25 Å
SCOPe Domain Sequences for d4hx2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx2d_ d.84.1.0 (D:) automated matches {Streptomyces caespitosus [TaxId: 53502]} gpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrllaap dpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
Timeline for d4hx2d_:
View in 3D Domains from other chains: (mouse over for more information) d4hx2a_, d4hx2b1, d4hx2b2, d4hx2c_ |