Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) |
Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
Protein automated matches [193340] (1 species) not a true protein |
Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries) |
Domain d4hx2b1: 4hx2 B:1-113 [234722] Other proteins in same PDB: d4hx2a_, d4hx2b2, d4hx2c_ automated match to d4hx3d_ complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn |
PDB Entry: 4hx2 (more details), 2.25 Å
SCOPe Domain Sequences for d4hx2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx2b1 d.84.1.0 (B:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]} sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
Timeline for d4hx2b1: