![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
![]() | Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
![]() | Protein automated matches [227930] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [227937] (4 PDB entries) |
![]() | Domain d4hwsb2: 4hws B:533-639 [234721] Other proteins in same PDB: d4hwsa1, d4hwsb1 automated match to d4hwpb2 protein/RNA complex; complexed with 1b3, zn |
PDB Entry: 4hws (more details), 1.7 Å
SCOPe Domain Sequences for d4hwsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwsb2 c.51.1.0 (B:533-639) automated matches {Escherichia coli [TaxId: 83333]} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkq
Timeline for d4hwsb2: