Lineage for d4hwsb1 (4hws B:242-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208773Protein automated matches [193659] (6 species)
    not a true protein
  7. 2208788Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries)
  8. 2208790Domain d4hwsb1: 4hws B:242-532 [234720]
    Other proteins in same PDB: d4hwsa2, d4hwsa3, d4hwsb2
    automated match to d4hwpb1
    protein/RNA complex; complexed with 1b3, zn

Details for d4hwsb1

PDB Entry: 4hws (more details), 1.7 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwsb1 d.104.1.1 (B:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d4hwsb1:

Click to download the PDB-style file with coordinates for d4hwsb1.
(The format of our PDB-style files is described here.)

Timeline for d4hwsb1: