Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein automated matches [193659] (5 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries) |
Domain d4hwrb1: 4hwr B:242-532 [234716] Other proteins in same PDB: d4hwra2 automated match to d4hwpb1 protein/RNA complex; complexed with 1b2, zn |
PDB Entry: 4hwr (more details), 1.9 Å
SCOPe Domain Sequences for d4hwrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwrb1 d.104.1.1 (B:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]} rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf
Timeline for d4hwrb1: