SCOPe 2.05: Domain d4hwra2: 4hwr A:533-643

Lineage for d4hwra2 (4hwr A:533-643)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [227937] (6 PDB entries)

8. Domain d4hwra2: 4hwr A:533-643 [234713]
   Other proteins in same PDB: d4hwra1, d4hwrb1
   automated match to d4hwpb2
   protein/RNA complex; complexed with 1b2, zn

Details for d4hwra2

PDB Entry: 4hwr, 1.9 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwra2:

Sequence; same for both SEQRES and ATOM records:

>d4hwra2 c.51.1.0 (A:533-643) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleel

Timeline for d4hwra2:

• d4hwra2 first appeared in SCOPe 2.03
  
• d4hwra2 appears in SCOPe 2.04
  
• d4hwra2 appears in SCOPe 2.06
  
• d4hwra2 appears in the current release, SCOPe 2.08