Lineage for d4hwob2 (4hwo B:533-639)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489886Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2489887Protein automated matches [227930] (6 species)
    not a true protein
  7. 2489895Species Escherichia coli K-12 [TaxId:83333] [227937] (6 PDB entries)
  8. 2489901Domain d4hwob2: 4hwo B:533-639 [234712]
    Other proteins in same PDB: d4hwoa1, d4hwoa3, d4hwob1
    automated match to d4hwpb2
    protein/RNA complex; complexed with 409, zn

Details for d4hwob2

PDB Entry: 4hwo (more details), 1.91 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwob2 c.51.1.0 (B:533-639) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkq

SCOPe Domain Coordinates for d4hwob2:

Click to download the PDB-style file with coordinates for d4hwob2.
(The format of our PDB-style files is described here.)

Timeline for d4hwob2: