Lineage for d4hwoa1 (4hwo A:242-532)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967844Protein automated matches [193659] (8 species)
    not a true protein
  7. 2967859Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries)
  8. 2967864Domain d4hwoa1: 4hwo A:242-532 [234708]
    Other proteins in same PDB: d4hwoa2, d4hwoa3, d4hwob2
    automated match to d4hwpb1
    protein/RNA complex; complexed with 409, zn

Details for d4hwoa1

PDB Entry: 4hwo (more details), 1.91 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwoa1 d.104.1.1 (A:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d4hwoa1:

Click to download the PDB-style file with coordinates for d4hwoa1.
(The format of our PDB-style files is described here.)

Timeline for d4hwoa1: