| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries) |
| Domain d4hvfc1: 4hvf C:2-220 [234706] Other proteins in same PDB: d4hvfa2, d4hvfb2, d4hvfc2, d4hvfd2 automated match to d4hvfd_ complexed with gol |
PDB Entry: 4hvf (more details), 1.7 Å
SCOPe Domain Sequences for d4hvfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hvfc1 d.22.1.0 (C:2-220) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
llpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigygf
yqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvigt
gfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfakp
iaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
Timeline for d4hvfc1: