SCOPe 2.07: Domain d4hvfb1: 4hvf B:2-220

Lineage for d4hvfb1 (4hvf B:2-220)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)

8. Domain d4hvfb1: 4hvf B:2-220 [234705]
   Other proteins in same PDB: d4hvfa2, d4hvfb2, d4hvfc2, d4hvfd2
   automated match to d4hvfd_
   complexed with gol

Details for d4hvfb1

PDB Entry: 4hvf, 1.7 Å

PDB Description: crystal structure of green fluorescent protein langfp(branchiostoma lanceolatum)

PDB Compounds: (B:) Green fluorescent protein blFP-Y6

SCOPe Domain Sequences for d4hvfb1:

Sequence; same for both SEQRES and ATOM records:

>d4hvfb1 d.22.1.0 (B:2-220) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
llpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigygf
yqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvigt
gfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfakp
iaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm

Timeline for d4hvfb1:

• d4hvfb1 first appeared in SCOPe 2.03, called d4hvfb_
  
• d4hvfb1 appears in SCOPe 2.06
  
• d4hvfb1 appears in the current release, SCOPe 2.08