Lineage for d4hvfa_ (4hvf A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643884Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1643885Protein automated matches [190526] (18 species)
    not a true protein
  7. 1643886Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (4 PDB entries)
  8. 1643887Domain d4hvfa_: 4hvf A: [234704]
    automated match to d4hvfd_
    complexed with gol

Details for d4hvfa_

PDB Entry: 4hvf (more details), 1.7 Å

PDB Description: crystal structure of green fluorescent protein langfp(branchiostoma lanceolatum)
PDB Compounds: (A:) Green fluorescent protein blFP-Y6

SCOPe Domain Sequences for d4hvfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hvfa_ d.22.1.0 (A:) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm

SCOPe Domain Coordinates for d4hvfa_:

Click to download the PDB-style file with coordinates for d4hvfa_.
(The format of our PDB-style files is described here.)

Timeline for d4hvfa_: